SCOPe 2.08: Domain d2w0lb1: 2w0l B:1-95

Lineage for d2w0lb1 (2w0l B:1-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d2w0lb1: 2w0l B:1-95 [198467]
   Other proteins in same PDB: d2w0la2, d2w0lb2, d2w0lc2, d2w0ld2
   automated match to d2w0ld_
   mutant

Details for d2w0lb1

PDB Entry: 2w0l, 2.2 Å

PDB Description: crystal structure of the mutant h8p from the recombinant variable domain 6jal2

PDB Compounds: (B:) v1-22 protein

SCOPe Domain Sequences for d2w0lb1:

Sequence; same for both SEQRES and ATOM records:

>d2w0lb1 b.1.1.1 (B:1-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssn

Timeline for d2w0lb1:

• d2w0lb1 first appeared in SCOPe 2.03, called d2w0lb_
  
• d2w0lb1 appears in SCOPe 2.07