PDB entry 2w0l

View 2w0l on RCSB PDB site
Description: crystal structure of the mutant h8p from the recombinant variable domain 6jal2
Class: immune system
Keywords: fibrils, germ line, antibodies, fibrinogenic, immune system
Deposited on 2008-08-19, released 2009-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v1-22 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: V1-22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV88 (0-97)
      • engineered mutation (7)
      • expression tag (97)
      • expression tag (99-110)
    Domains in SCOPe 2.08: d2w0la1, d2w0la2
  • Chain 'B':
    Compound: v1-22 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: V1-22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV88 (0-97)
      • engineered mutation (7)
      • expression tag (97)
      • expression tag (99-110)
    Domains in SCOPe 2.08: d2w0lb1, d2w0lb2
  • Chain 'C':
    Compound: v1-22 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: V1-22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV88 (0-97)
      • engineered mutation (7)
      • expression tag (97)
      • expression tag (99-110)
    Domains in SCOPe 2.08: d2w0lc1, d2w0lc2
  • Chain 'D':
    Compound: v1-22 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: V1-22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV88 (0-97)
      • engineered mutation (7)
      • expression tag (97)
      • expression tag (99-110)
    Domains in SCOPe 2.08: d2w0ld1, d2w0ld2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w0lA (A:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w0lB (B:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w0lC (C:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w0lD (D:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl