Lineage for d2w0lc1 (2w0l C:1-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742942Domain d2w0lc1: 2w0l C:1-95 [198468]
    Other proteins in same PDB: d2w0la2, d2w0lb2, d2w0lc2, d2w0ld2
    automated match to d2w0ld_
    mutant

Details for d2w0lc1

PDB Entry: 2w0l (more details), 2.2 Å

PDB Description: crystal structure of the mutant h8p from the recombinant variable domain 6jal2
PDB Compounds: (C:) v1-22 protein

SCOPe Domain Sequences for d2w0lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0lc1 b.1.1.1 (C:1-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssn

SCOPe Domain Coordinates for d2w0lc1:

Click to download the PDB-style file with coordinates for d2w0lc1.
(The format of our PDB-style files is described here.)

Timeline for d2w0lc1: