Lineage for d2uudk_ (2uud K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745149Domain d2uudk_: 2uud K: [198344]
    Other proteins in same PDB: d2uudh1, d2uudj1
    automated match to d1fvcc_
    complexed with phx

Details for d2uudk_

PDB Entry: 2uud (more details), 2.9 Å

PDB Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10-1.12 scfv in complex with the hapten
PDB Compounds: (K:) nq10-1.12 anti-phox antibody

SCOPe Domain Sequences for d2uudk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uudk_ b.1.1.1 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr

SCOPe Domain Coordinates for d2uudk_:

Click to download the PDB-style file with coordinates for d2uudk_.
(The format of our PDB-style files is described here.)

Timeline for d2uudk_: