Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
Domain d2uudk_: 2uud K: [198344] Other proteins in same PDB: d2uudh1, d2uudj1 automated match to d1fvcc_ complexed with phx |
PDB Entry: 2uud (more details), 2.9 Å
SCOPe Domain Sequences for d2uudk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uudk_ b.1.1.1 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
Timeline for d2uudk_: