Lineage for d2uudj1 (2uud J:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739974Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2740046Domain d2uudj1: 2uud J:1-113 [152182]
    Other proteins in same PDB: d2uudk_, d2uudl_
    complexed with phx

Details for d2uudj1

PDB Entry: 2uud (more details), 2.9 Å

PDB Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10-1.12 scfv in complex with the hapten
PDB Compounds: (J:) nq10-1.12 anti-phox antibody

SCOPe Domain Sequences for d2uudj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uudj1 b.1.1.1 (J:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
dysasvkgrftisrdnsqsilylqmntlraedsatyycargdyygawfaywgqgtlvtvs
a

SCOPe Domain Coordinates for d2uudj1:

Click to download the PDB-style file with coordinates for d2uudj1.
(The format of our PDB-style files is described here.)

Timeline for d2uudj1: