PDB entry 2uud

View 2uud on RCSB PDB site
Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10-1.12 scfv in complex with the hapten
Class: immune system
Keywords: scfv, antibody, immunoglobulin, 2-phenyl-5-oxazolone, immunoglobulin domain, immune system
Deposited on 2007-03-02, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUD (0-17)
    Domains in SCOPe 2.08: d2uudh1
  • Chain 'J':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UUD (0-17)
    Domains in SCOPe 2.08: d2uudj1
  • Chain 'K':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.08: d2uudk_
  • Chain 'L':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.08: d2uudl_
  • Chain 'S':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
  • Chain 'T':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus [TaxId:10090]
  • Heterogens: PHX, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uudH (H:)
    evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
    dysasvkgrftisrdnsqsilylqmntlraedsatyycargdyygawfaywgqgtlvtvs
    a
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uudJ (J:)
    evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
    dysasvkgrftisrdnsqsilylqmntlraedsatyycargdyygawfaywgqgtlvtvs
    a
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uudK (K:)
    qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2uudL (L:)
    qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.