SCOPe 2.08: Domain d2oppa3: 2opp A:430-539

Lineage for d2oppa3 (2opp A:430-539)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)

8. Domain d2oppa3: 2opp A:430-539 [198207]
   Other proteins in same PDB: d2oppa2, d2oppb_
   complexed with hbq, mg, po4

Details for d2oppa3

PDB Entry: 2opp, 2.55 Å

PDB Description: Crystal Structure of HIV-1 Reverse Transcriptase in Complex with GW420867X.

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2oppa3:

Sequence, based on SEQRES records:

>d2oppa3 c.55.3.0 (A:430-539) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Sequence, based on observed residues (ATOM records):

>d2oppa3 c.55.3.0 (A:430-539) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Timeline for d2oppa3:

• d2oppa3 first appeared in SCOPe 2.03
  
• d2oppa3 appears in SCOPe 2.07