Lineage for d2oppb_ (2opp B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3016822Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 3016823Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (22 PDB entries)
  8. 3016850Domain d2oppb_: 2opp B: [139213]
    Other proteins in same PDB: d2oppa3
    automated match to d1c1bb_
    complexed with hbq, mg, po4

Details for d2oppb_

PDB Entry: 2opp (more details), 2.55 Å

PDB Description: Crystal Structure of HIV-1 Reverse Transcriptase in Complex with GW420867X.
PDB Compounds: (B:) p51 RT

SCOPe Domain Sequences for d2oppb_:

Sequence, based on SEQRES records: (download)

>d2oppb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwyqlek

Sequence, based on observed residues (ATOM records): (download)

>d2oppb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwphpaglkkkksvtvldvgdayfsvpldedfrkytaf
tipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvg
sdleigqhrtkieelrqhllrweppflwyelhpdkwtvqpivlpekdswtvndiqklvgk
lnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpsk
dliaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgktpk
fklpiqketwetwwteywqatwipewefvntpplvklwyqlek

SCOPe Domain Coordinates for d2oppb_:

Click to download the PDB-style file with coordinates for d2oppb_.
(The format of our PDB-style files is described here.)

Timeline for d2oppb_: