Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Uncharacterized protein C1556.08c [160166] (1 species) consists of 4 CBS units |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160167] (2 PDB entries) Uniprot Q10343 182-334! Uniprot Q10343 3-181 |
Domain d2ooye2: 2ooy E:182-334 [198203] Other proteins in same PDB: d2ooya_, d2ooyb_, d2ooyc_, d2ooyd_, d2ooye3, d2ooyg3 automated match to d2ooxe2 complexed with atp, flc |
PDB Entry: 2ooy (more details), 2.88 Å
SCOPe Domain Sequences for d2ooye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ooye2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle gilsladilnyiiydktttpgvpeqtdnfesav
Timeline for d2ooye2: