Lineage for d2ooye2 (2ooy E:182-334)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187447Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2187448Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2187449Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2187549Protein Uncharacterized protein C1556.08c [160166] (1 species)
    consists of 4 CBS units
  7. 2187550Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160167] (2 PDB entries)
    Uniprot Q10343 182-334! Uniprot Q10343 3-181
  8. 2187556Domain d2ooye2: 2ooy E:182-334 [198203]
    Other proteins in same PDB: d2ooya_, d2ooyb_, d2ooyc_, d2ooyd_, d2ooye3, d2ooyg3
    automated match to d2ooxe2
    complexed with atp, flc

Details for d2ooye2

PDB Entry: 2ooy (more details), 2.88 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP
PDB Compounds: (E:) Hypothetical protein C1556.08c in chromosome I

SCOPe Domain Sequences for d2ooye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooye2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
gilsladilnyiiydktttpgvpeqtdnfesav

SCOPe Domain Coordinates for d2ooye2:

Click to download the PDB-style file with coordinates for d2ooye2.
(The format of our PDB-style files is described here.)

Timeline for d2ooye2: