SCOPe 2.03: Domain d2ooye2: 2ooy E:182-334

Lineage for d2ooye2 (2ooy E:182-334)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Uncharacterized protein C1556.08c [160166] (1 species)
   consists of 4 CBS units

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160167] (2 PDB entries)
   Uniprot Q10343 182-334! Uniprot Q10343 3-181

8. Domain d2ooye2: 2ooy E:182-334 [198203]
   Other proteins in same PDB: d2ooya_, d2ooyb_, d2ooyc_, d2ooyd_
   automated match to d2ooxe2
   complexed with atp, flc

Details for d2ooye2

PDB Entry: 2ooy, 2.88 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP

PDB Compounds: (E:) Hypothetical protein C1556.08c in chromosome I

SCOPe Domain Sequences for d2ooye2:

Sequence; same for both SEQRES and ATOM records:

>d2ooye2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
gilsladilnyiiydktttpgvpeqtdnfesav

Timeline for d2ooye2:

• d2ooye2 is new in SCOPe 2.03-stable
  
• d2ooye2 appears in SCOPe 2.04
  
• d2ooye2 appears in the current release, SCOPe 2.08