SCOPe 2.04: Domain d2nqbg_: 2nqb G:

Lineage for d2nqbg_ (2nqb G:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (2 PDB entries)

8. Domain d2nqbg_: 2nqb G: [198176]
   Other proteins in same PDB: d2nqba_, d2nqbb_, d2nqbe_, d2nqbf_
   automated match to d1id3c_
   protein/DNA complex

Details for d2nqbg_

PDB Entry: 2nqb, 2.3 Å

PDB Description: drosophila nucleosome structure

PDB Compounds: (G:) histone h2a

SCOPe Domain Sequences for d2nqbg_:

Sequence; same for both SEQRES and ATOM records:

>d2nqbg_ a.22.1.1 (G:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aksrsnraglqfpvgrihrllrkgnyaervgagapvylaavmeylaaevlelagnaardn
kktriiprhlqlairndeelnkllsgvtiaqggvlpniqavllpk

Timeline for d2nqbg_:

• d2nqbg_ first appeared in SCOPe 2.03
  
• d2nqbg_ appears in SCOPe 2.05
  
• d2nqbg_ appears in the current release, SCOPe 2.08