Lineage for d2gbxc1 (2gbx C:6-152)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2392187Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2392188Protein automated matches [190701] (13 species)
    not a true protein
  7. 2392337Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries)
  8. 2392344Domain d2gbxc1: 2gbx C:6-152 [197946]
    Other proteins in same PDB: d2gbxa2, d2gbxb_, d2gbxc2, d2gbxd_, d2gbxe2, d2gbxf_
    automated match to d1o7na1
    complexed with bnl, fe, fes, zn

Details for d2gbxc1

PDB Entry: 2gbx (more details), 2.8 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl
PDB Compounds: (C:) Biphenyl 2,3-Dioxygenase Alpha Subunit

SCOPe Domain Sequences for d2gbxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbxc1 b.33.1.0 (C:6-152) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
tlvdtvnasqsrqvfwdedvyaleierifsrawlmlgheslvpkpgdfittymaedkvil
shqsdgtfrafinscshrgnqichadsgnakafvcnyhgwvfgqdgslvdvplesrcyhn
sldkqklaaksvrvetykgfifgchdp

SCOPe Domain Coordinates for d2gbxc1:

Click to download the PDB-style file with coordinates for d2gbxc1.
(The format of our PDB-style files is described here.)

Timeline for d2gbxc1: