SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2gbxc1 (2gbx C:6-152)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045320Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2045321Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2045541Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2045542Protein automated matches [190701] (11 species)
    not a true protein
  7. 2045641Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries)
  8. 2045648Domain d2gbxc1: 2gbx C:6-152 [197946]
    Other proteins in same PDB: d2gbxa2, d2gbxb_, d2gbxc2, d2gbxd_, d2gbxe2, d2gbxf_
    automated match to d1o7na1
    complexed with bnl, fe, fes, zn

Details for d2gbxc1

PDB Entry: 2gbx (more details), 2.8 Å

PDB Description: Crystal Structure of Biphenyl 2,3-Dioxygenase from Sphingomonas yanoikuyae B1 Bound to Biphenyl
PDB Compounds: (C:) Biphenyl 2,3-Dioxygenase Alpha Subunit

SCOPe Domain Sequences for d2gbxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbxc1 b.33.1.0 (C:6-152) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
tlvdtvnasqsrqvfwdedvyaleierifsrawlmlgheslvpkpgdfittymaedkvil
shqsdgtfrafinscshrgnqichadsgnakafvcnyhgwvfgqdgslvdvplesrcyhn
sldkqklaaksvrvetykgfifgchdp

SCOPe Domain Coordinates for d2gbxc1:

Click to download the PDB-style file with coordinates for d2gbxc1.
(The format of our PDB-style files is described here.)

Timeline for d2gbxc1: