| Class b: All beta proteins [48724] (177 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (11 species) not a true protein |
| Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries) |
| Domain d2gbxc1: 2gbx C:6-152 [197946] Other proteins in same PDB: d2gbxa2, d2gbxb_, d2gbxc2, d2gbxd_, d2gbxe2, d2gbxf_ automated match to d1o7na1 complexed with bnl, fe, fes, zn |
PDB Entry: 2gbx (more details), 2.8 Å
SCOPe Domain Sequences for d2gbxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbxc1 b.33.1.0 (C:6-152) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
tlvdtvnasqsrqvfwdedvyaleierifsrawlmlgheslvpkpgdfittymaedkvil
shqsdgtfrafinscshrgnqichadsgnakafvcnyhgwvfgqdgslvdvplesrcyhn
sldkqklaaksvrvetykgfifgchdp
Timeline for d2gbxc1: