SCOP 1.57: Domain d1ifhh1: 1ifh H:1-112

Lineage for d1ifhh1 (1ifh H:1-112)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 17/9 (mouse), kappa L chain [48757] (4 PDB entries)

8. Domain d1ifhh1: 1ifh H:1-112 [19791]
   Other proteins in same PDB: d1ifhh2, d1ifhl2

Details for d1ifhh1

PDB Entry: 1ifh, 2.8 Å

PDB Description: a detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes

SCOP Domain Sequences for d1ifhh1:

Sequence; same for both SEQRES and ATOM records:

>d1ifhh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvs

Timeline for d1ifhh1:

• d1ifhh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ifhh1 appears in SCOP 1.59
  
• d1ifhh1 appears in the current release, SCOPe 2.08