SCOP 1.57: Domain d1ifhl2: 1ifh L:109-212

Lineage for d1ifhl2 (1ifh L:109-212)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries)

8. Domain d1ifhl2: 1ifh L:109-212 [20900]
   Other proteins in same PDB: d1ifhh1, d1ifhl1

Details for d1ifhl2

PDB Entry: 1ifh, 2.8 Å

PDB Description: a detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes

SCOP Domain Sequences for d1ifhl2:

Sequence; same for both SEQRES and ATOM records:

>d1ifhl2 b.1.1.2 (L:109-212) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1ifhl2:

• d1ifhl2 first appeared (with stable ids) in SCOP 1.55
  
• d1ifhl2 appears in SCOP 1.59
  
• d1ifhl2 appears in the current release, SCOPe 2.08