SCOPe 2.08: Domain d1ifhh1: 1ifh H:1-112

Lineage for d1ifhh1 (1ifh H:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1ifhh1: 1ifh H:1-112 [19791]
   Other proteins in same PDB: d1ifhh2, d1ifhl1, d1ifhl2
   part of Fab 17/9

Details for d1ifhh1

PDB Entry: 1ifh, 2.8 Å

PDB Description: a detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes

PDB Compounds: (H:) igg2a-kappa 17/9 fab (heavy chain)

SCOPe Domain Sequences for d1ifhh1:

Sequence; same for both SEQRES and ATOM records:

>d1ifhh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvs

Timeline for d1ifhh1:

• d1ifhh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ifhh1 appears in SCOPe 2.07