PDB entry 1ifh

View 1ifh on RCSB PDB site
Description: a detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-05-06, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.17
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa 17/9 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38230 (0-219)
      • insertion (218)
    Domains in SCOPe 2.07: d1ifhh1, d1ifhh2
  • Chain 'L':
    Compound: igg2a-kappa 17/9 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR A31790 (0-217)
    Domains in SCOPe 2.07: d1ifhl1, d1ifhl2
  • Chain 'P':
    Compound: influenza hemagglutinin ha1 (strain x47) (residues 101-107)
    Database cross-references and differences (RAF-indexed):
    • PDB 1IFH (Start-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifhH (H:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifhL (L:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'P':
    No sequence available.