SCOPe 2.07: Domain d1yjdl1: 1yjd L:1-107

Lineage for d1yjdl1 (1yjd L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d1yjdl1: 1yjd L:1-107 [197661]
   Other proteins in same PDB: d1yjdc1, d1yjdh1, d1yjdh2, d1yjdl2
   automated match to d2fatl1
   complexed with nag

Details for d1yjdl1

PDB Entry: 1yjd, 2.7 Å

PDB Description: crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)

PDB Compounds: (L:) Fab fragment of 5.11A1 antibody light chain

SCOPe Domain Sequences for d1yjdl1:

Sequence; same for both SEQRES and ATOM records:

>d1yjdl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmnqspsslsaslgdtititchasqniyvwlnwyqqkpgnipklliykasnlhtgvps
rfsgsgsgtgftltisslqpediatyycqqgqtypytfgggtkleik

Timeline for d1yjdl1:

• d1yjdl1 first appeared in SCOPe 2.03
  
• d1yjdl1 appears in SCOPe 2.06
  
• d1yjdl1 appears in the current release, SCOPe 2.08