SCOPe 2.07: Domain d1yjdc1: 1yjd C:1-118

Lineage for d1yjdc1 (1yjd C:1-118)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD28 [158865] (1 species)
   T-cell-specific surface glycoprotein

7. Species Human (Homo sapiens) [TaxId:9606] [158866] (1 PDB entry)
   Uniprot P10747 19-136

8. Domain d1yjdc1: 1yjd C:1-118 [144649]
   Other proteins in same PDB: d1yjdh1, d1yjdh2, d1yjdl1, d1yjdl2
   complexed with nag

Details for d1yjdc1

PDB Entry: 1yjd, 2.7 Å

PDB Description: crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)

PDB Compounds: (C:) T-cell-specific surface glycoprotein CD28

SCOPe Domain Sequences for d1yjdc1:

Sequence; same for both SEQRES and ATOM records:

>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]}
nkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqqlqv
ysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvk

Timeline for d1yjdc1:

• d1yjdc1 first appeared in SCOP 1.75
  
• d1yjdc1 appears in SCOPe 2.06
  
• d1yjdc1 appears in the current release, SCOPe 2.08