Lineage for d1yjdl2 (1yjd L:108-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364345Domain d1yjdl2: 1yjd L:108-212 [197662]
    Other proteins in same PDB: d1yjdc1, d1yjdh1, d1yjdh2, d1yjdl1
    automated match to d2fd6l2
    complexed with nag

Details for d1yjdl2

PDB Entry: 1yjd (more details), 2.7 Å

PDB Description: crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
PDB Compounds: (L:) Fab fragment of 5.11A1 antibody light chain

SCOPe Domain Sequences for d1yjdl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjdl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d1yjdl2:

Click to download the PDB-style file with coordinates for d1yjdl2.
(The format of our PDB-style files is described here.)

Timeline for d1yjdl2: