![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species) |
![]() | Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries) Uniprot P03680 |
![]() | Domain d1xhxb1: 1xhx B:5-187 [197642] Other proteins in same PDB: d1xhxa2, d1xhxb2, d1xhxc2, d1xhxd2 automated match to d1xhxa1 complexed with mg, so4 |
PDB Entry: 1xhx (more details), 2.35 Å
SCOPe Domain Sequences for d1xhxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhxb1 c.55.3.5 (B:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg ldr
Timeline for d1xhxb1: