PDB entry 1xhx

View 1xhx on RCSB PDB site
Description: Phi29 DNA Polymerase, orthorhombic crystal form
Class: transferase
Keywords: DNA polymerase, protein-primed, strand displacement, processivity, replication, TRANSFERASE
Deposited on 2004-09-21, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.07: d1xhxa1, d1xhxa2
  • Chain 'B':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.07: d1xhxb1, d1xhxb2
  • Chain 'C':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.07: d1xhxc1, d1xhxc2
  • Chain 'D':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.07: d1xhxd1, d1xhxd2
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhxA (A:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhxA (A:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhxB (B:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhxB (B:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xhxC (C:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhxC (C:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xhxD (D:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhxD (D:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik