Lineage for d3qsua_ (3qsu A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2380771Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2380772Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2380854Species Staphylococcus aureus [TaxId:1280] [74941] (3 PDB entries)
  8. 2380873Domain d3qsua_: 3qsu A: [197430]
    automated match to d1kq1h_
    protein/RNA complex; complexed with zn

Details for d3qsua_

PDB Entry: 3qsu (more details), 2.2 Å

PDB Description: structure of staphylococcus aureus hfq in complex with a7 rna
PDB Compounds: (A:) RNA chaperone Hfq

SCOPe Domain Sequences for d3qsua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qsua_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv

SCOPe Domain Coordinates for d3qsua_:

Click to download the PDB-style file with coordinates for d3qsua_.
(The format of our PDB-style files is described here.)

Timeline for d3qsua_: