Lineage for d3qsua_ (3qsu A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123327Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 1123368Protein automated matches [190062] (7 species)
    not a true protein
  7. 1123440Species Staphylococcus aureus [TaxId:889933] [193521] (1 PDB entry)
  8. 1123441Domain d3qsua_: 3qsu A: [197430]
    automated match to d1kq1h_
    protein/RNA complex; complexed with zn

Details for d3qsua_

PDB Entry: 3qsu (more details), 2.2 Å

PDB Description: structure of staphylococcus aureus hfq in complex with a7 rna
PDB Compounds: (A:) RNA chaperone Hfq

SCOPe Domain Sequences for d3qsua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qsua_ b.38.1.2 (A:) automated matches {Staphylococcus aureus [TaxId: 889933]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv

SCOPe Domain Coordinates for d3qsua_:

Click to download the PDB-style file with coordinates for d3qsua_.
(The format of our PDB-style files is described here.)

Timeline for d3qsua_: