Class b: All beta proteins [48724] (174 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
Protein automated matches [190062] (7 species) not a true protein |
Species Staphylococcus aureus [TaxId:889933] [193521] (1 PDB entry) |
Domain d3qsua_: 3qsu A: [197430] automated match to d1kq1h_ protein/RNA complex; complexed with zn |
PDB Entry: 3qsu (more details), 2.2 Å
SCOPe Domain Sequences for d3qsua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qsua_ b.38.1.2 (A:) automated matches {Staphylococcus aureus [TaxId: 889933]} niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
Timeline for d3qsua_: