SCOPe 2.04: Domain d4kpva_: 4kpv A:

Lineage for d4kpva_ (4kpv A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (55 PDB entries)

8. Domain d4kpva_: 4kpv A: [197209]
   automated match to d3s9qa_
   complexed with nag, ura

Details for d4kpva_

PDB Entry: 4kpv, 2.57 Å

PDB Description: crystal structure of the complex of ribosome inactivating protein from momordica balsamina with pyrimidine-2,4(1h,3h)-dione at 2.57 a resolution

PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4kpva_:

Sequence; same for both SEQRES and ATOM records:

>d4kpva_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d4kpva_:

• d4kpva_ first appeared in SCOPe 2.02
  
• d4kpva_ appears in SCOPe 2.03
  
• d4kpva_ appears in SCOPe 2.05
  
• d4kpva_ appears in the current release, SCOPe 2.08