SCOPe 2.08: Domain d3zlra1: 3zlr A:1-197

Lineage for d3zlra1 (3zlr A:1-197)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)

8. Domain d3zlra1: 3zlr A:1-197 [197065]
   Other proteins in same PDB: d3zlra2
   automated match to d2yj1a_
   complexed with edo, so4, x0b

Details for d3zlra1

PDB Entry: 3zlr, 2.03 Å

PDB Description: crystal structure of bcl-xl in complex with inhibitor (wehi-539)

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3zlra1:

Sequence; same for both SEQRES and ATOM records:

>d3zlra1 f.1.4.1 (A:1-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygn

Timeline for d3zlra1:

• d3zlra1 first appeared in SCOPe 2.02, called d3zlra_
  
• d3zlra1 appears in SCOPe 2.07