Lineage for d4en1b_ (4en1 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199443Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (35 PDB entries)
  8. 1199466Domain d4en1b_: 4en1 B: [196885]
    automated match to d3st3a_
    complexed with act, gol, peg, so4

Details for d4en1b_

PDB Entry: 4en1 (more details), 1.62 Å

PDB Description: The 1.62A structure of a FRET-optimized Cerulean Fluorescent Protein
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d4en1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4en1b_ d.22.1.1 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleynaihgnvyitadkqkngikanfglncniedgsvqladhyqq
ntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d4en1b_:

Click to download the PDB-style file with coordinates for d4en1b_.
(The format of our PDB-style files is described here.)

Timeline for d4en1b_: