SCOPe 2.04: Domain d3tnja_: 3tnj A:

Lineage for d3tnja_ (3tnj A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (16 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:228410] [187986] (2 PDB entries)

8. Domain d3tnja_: 3tnj A: [196870]
   automated match to d2pfsa_
   complexed with amp

Details for d3tnja_

PDB Entry: 3tnj, 2 Å

PDB Description: crystal structure of universal stress protein from nitrosomonas europaea with amp bound

PDB Compounds: (A:) Universal stress protein (Usp)

SCOPe Domain Sequences for d3tnja_:

Sequence, based on SEQRES records:

>d3tnja_ c.26.2.0 (A:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
svyhhillavdfssedsqvvqkvrnlasqigarlslihvldnipmpdtpygtaipldtet
tydamldvekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshgrhgl
alllgstansvlhyakcdvlavrlrd

Sequence, based on observed residues (ATOM records):

>d3tnja_ c.26.2.0 (A:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
svyhhillavdfssedsqvvqkvrnlasqigarlslihvldygtaipldtettydamldv
ekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshlgstansvlhyak
cdvlavrlrd

Timeline for d3tnja_:

• d3tnja_ first appeared in SCOPe 2.02
  
• d3tnja_ appears in SCOPe 2.03
  
• d3tnja_ appears in SCOPe 2.05
  
• d3tnja_ appears in the current release, SCOPe 2.08