PDB entry 3tnj

View 3tnj on RCSB PDB site
Description: Crystal structure of universal stress protein from Nitrosomonas europaea with AMP bound
Class: chaperone
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, universal stress protein, CHAPERONE
Deposited on 2011-09-01, released 2011-09-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Universal stress protein (Usp)
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: NE1028
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tnja_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tnjA (A:)
    ghmsvyhhillavdfssedsqvvqkvrnlasqigarlslihvldnipmpdtpygtaipld
    tettydamldvekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshgr
    hglalllgstansvlhyakcdvlavrlrdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnjA (A:)
    svyhhillavdfssedsqvvqkvrnlasqigarlslihvldygtaipldtettydamldv
    ekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshlgstansvlhyak
    cdvlavrlrd