Lineage for d3tnja_ (3tnj A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1360010Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1360260Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1360261Protein automated matches [190116] (13 species)
    not a true protein
  7. 1360299Species Nitrosomonas europaea [TaxId:228410] [187986] (2 PDB entries)
  8. 1360300Domain d3tnja_: 3tnj A: [196870]
    automated match to d2pfsa_
    complexed with amp

Details for d3tnja_

PDB Entry: 3tnj (more details), 2 Å

PDB Description: crystal structure of universal stress protein from nitrosomonas europaea with amp bound
PDB Compounds: (A:) Universal stress protein (Usp)

SCOPe Domain Sequences for d3tnja_:

Sequence, based on SEQRES records: (download)

>d3tnja_ c.26.2.0 (A:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
svyhhillavdfssedsqvvqkvrnlasqigarlslihvldnipmpdtpygtaipldtet
tydamldvekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshgrhgl
alllgstansvlhyakcdvlavrlrd

Sequence, based on observed residues (ATOM records): (download)

>d3tnja_ c.26.2.0 (A:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
svyhhillavdfssedsqvvqkvrnlasqigarlslihvldygtaipldtettydamldv
ekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshlgstansvlhyak
cdvlavrlrd

SCOPe Domain Coordinates for d3tnja_:

Click to download the PDB-style file with coordinates for d3tnja_.
(The format of our PDB-style files is described here.)

Timeline for d3tnja_: