| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
| Protein automated matches [190116] (13 species) not a true protein |
| Species Nitrosomonas europaea [TaxId:228410] [187986] (2 PDB entries) |
| Domain d3tnja_: 3tnj A: [196870] automated match to d2pfsa_ complexed with amp |
PDB Entry: 3tnj (more details), 2 Å
SCOPe Domain Sequences for d3tnja_:
Sequence, based on SEQRES records: (download)
>d3tnja_ c.26.2.0 (A:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
svyhhillavdfssedsqvvqkvrnlasqigarlslihvldnipmpdtpygtaipldtet
tydamldvekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshgrhgl
alllgstansvlhyakcdvlavrlrd
>d3tnja_ c.26.2.0 (A:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
svyhhillavdfssedsqvvqkvrnlasqigarlslihvldygtaipldtettydamldv
ekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshlgstansvlhyak
cdvlavrlrd
Timeline for d3tnja_: