SCOPe 2.08: Domain d1ehja_: 1ehj A:

Lineage for d1ehja_ (1ehj A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
   contains three heme groups; deletion of one of Cyt c3 heme-binding sites

7. Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries)

8. Domain d1ehja_: 1ehj A: [19667]
   complexed with hec

Details for d1ehja_

PDB Entry: 1ehj

PDB Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans

PDB Compounds: (A:) cytochrome c7

SCOPe Domain Sequences for d1ehja_:

Sequence; same for both SEQRES and ATOM records:

>d1ehja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans [TaxId: 891]}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

Timeline for d1ehja_:

• d1ehja_ first appeared (with stable ids) in SCOP 1.55
  
• d1ehja_ appears in SCOPe 2.07