Lineage for d1ehja_ (1ehj A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6906Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 6907Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 6908Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins)
  6. 6931Protein Cytochrome c7 (cytochrome c551.5) [48703] (1 species)
  7. 6932Species Desulfuromonas acetoxidans [TaxId:891] [48704] (4 PDB entries)
  8. 6935Domain d1ehja_: 1ehj A: [19667]

Details for d1ehja_

PDB Entry: 1ehj (more details)

PDB Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans

SCOP Domain Sequences for d1ehja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5) {Desulfuromonas acetoxidans}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

SCOP Domain Coordinates for d1ehja_:

Click to download the PDB-style file with coordinates for d1ehja_.
(The format of our PDB-style files is described here.)

Timeline for d1ehja_: