PDB entry 1ehj

View 1ehj on RCSB PDB site
Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans
Class: electron transport
Keywords: multi-heme, ELECTRON TRANSPORT
Deposited on 2000-02-21, released 2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c7
  Species: Desulfuromonas acetoxidans [TaxId:891]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00137 (0-67)
  Domains in SCOPe 2.08: d1ehja_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehjA (A:)
  advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
  kcggchik