SCOP 1.69: Domain d1new__: 1new -

Lineage for d1new__ (1new -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)

6. Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
   contains three heme groups; deletion of one of Cyt c3 heme-binding sites

7. Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries)

8. Domain d1new__: 1new - [19664]

Details for d1new__

PDB Entry: 1new

PDB Description: cytochrome c551.5, nmr

SCOP Domain Sequences for d1new__:

Sequence; same for both SEQRES and ATOM records:

>d1new__ a.138.1.1 (-) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

Timeline for d1new__:

• d1new__ first appeared (with stable ids) in SCOP 1.55
  
• d1new__ appears in SCOP 1.67
  
• d1new__ appears in SCOP 1.71
  
• d1new__ appears in the current release, SCOPe 2.08, called d1newa_