PDB entry 1new

View 1new on RCSB PDB site
Description: cytochrome c551.5, nmr
Deposited on 1998-02-10, released 1998-04-29
The last revision prior to the SCOP 1.69 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1new__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1new_ (-)
    advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
    kcggchik