| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
| Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species) contains three heme groups; deletion of one of Cyt c3 heme-binding sites |
| Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries) |
| Domain d1newa_: 1new A: [19664] complexed with hec |
PDB Entry: 1new (more details)
SCOPe Domain Sequences for d1newa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1newa_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans [TaxId: 891]}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik
Timeline for d1newa_: