Lineage for d3zdgd_ (3zdg D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561825Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1561826Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1561827Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. Protein automated matches [190922] (2 species)
    not a true protein
  7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (11 PDB entries)
  8. 1561923Domain d3zdgd_: 3zdg D: [196626]
    Other proteins in same PDB: d3zdga_, d3zdgb_, d3zdgc_, d3zdgh_, d3zdgi_, d3zdgj_, d3zdgk_, d3zdgl_, d3zdgm_, d3zdgn_, d3zdgo_, d3zdgp_, d3zdgq_, d3zdgr_, d3zdgs_, d3zdgt_
    automated match to d3u8jb_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdgd_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: crystal structure of ls-achbp complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (dmabc)
PDB Compounds: (D:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdgd_:

Sequence, based on SEQRES records: (download)

>d3zdgd_ b.96.1.1 (D:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d3zdgd_ b.96.1.1 (D:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkk

SCOPe Domain Coordinates for d3zdgd_:

Click to download the PDB-style file with coordinates for d3zdgd_.
(The format of our PDB-style files is described here.)

Timeline for d3zdgd_: