Lineage for d3zdgn_ (3zdg N:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561825Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1561826Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1561827Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1561828Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 1561829Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 1561849Domain d3zdgn_: 3zdg N: [201298]
    Other proteins in same PDB: d3zdgd_, d3zdge_, d3zdgf_, d3zdgg_
    automated match to d1uv6a_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdgn_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: crystal structure of ls-achbp complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (dmabc)
PDB Compounds: (N:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdgn_:

Sequence, based on SEQRES records: (download)

>d3zdgn_ b.96.1.1 (N:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d3zdgn_ b.96.1.1 (N:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpteyfsqysrfeildvtqkknsvtysc
cpeayedvevslnfrkk

SCOPe Domain Coordinates for d3zdgn_:

Click to download the PDB-style file with coordinates for d3zdgn_.
(The format of our PDB-style files is described here.)

Timeline for d3zdgn_: