![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (17 PDB entries) |
![]() | Domain d1tbgf_: 1tbg F: [19631] Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_ |
PDB Entry: 1tbg (more details), 2.1 Å
SCOPe Domain Sequences for d1tbgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbgf_ a.137.3.1 (F:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped knpfk
Timeline for d1tbgf_: