Lineage for d1tbgf_ (1tbg F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339610Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2339611Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 protein domains)
  6. 2339612Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2339613Species Cow (Bos taurus) [TaxId:9913] [48673] (32 PDB entries)
  8. 2339616Domain d1tbgf_: 1tbg F: [19631]
    Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_

Details for d1tbgf_

PDB Entry: 1tbg (more details), 2.1 Å

PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin
PDB Compounds: (F:) transducin

SCOPe Domain Sequences for d1tbgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbgf_ a.137.3.1 (F:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfk

SCOPe Domain Coordinates for d1tbgf_:

Click to download the PDB-style file with coordinates for d1tbgf_.
(The format of our PDB-style files is described here.)

Timeline for d1tbgf_: