Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries) |
Domain d3oljd1: 3olj D:66-350 [196199] Other proteins in same PDB: d3olja2, d3oljb2, d3oljc2, d3oljd2 automated match to d2uw2a1 complexed with na |
PDB Entry: 3olj (more details), 2.1 Å
SCOPe Domain Sequences for d3oljd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oljd1 a.25.1.2 (D:66-350) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeevdlskdiqhweslkpeery fishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyik dpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifw lkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqeflt ealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm
Timeline for d3oljd1: