Lineage for d3oljd_ (3olj D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085170Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1085457Protein automated matches [190435] (5 species)
    not a true protein
  7. 1085487Species Homo sapiens [TaxId:9606] [193902] (5 PDB entries)
  8. 1085488Domain d3oljd_: 3olj D: [196199]
    automated match to d2uw2a1
    complexed with na

Details for d3oljd_

PDB Entry: 3olj (more details), 2.1 Å

PDB Description: Crystal structure of human ribonucleotide reductase subunit M2 (hRRM2)
PDB Compounds: (D:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3oljd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oljd_ a.25.1.2 (D:) automated matches {Homo sapiens [TaxId: 9606]}
mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeevdlskdiqhweslkpeer
yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

SCOPe Domain Coordinates for d3oljd_:

Click to download the PDB-style file with coordinates for d3oljd_.
(The format of our PDB-style files is described here.)

Timeline for d3oljd_:

  • d3oljd_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-28
  • d3oljd_ appears in SCOPe 2.03
  • d3oljd_ appears in the current release, SCOPe 2.06, called d3oljd1