Lineage for d3olja1 (3olj A:66-350)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316867Protein automated matches [190435] (12 species)
    not a true protein
  7. 2316939Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries)
  8. 2316940Domain d3olja1: 3olj A:66-350 [200095]
    Other proteins in same PDB: d3olja2, d3oljb2, d3oljc2, d3oljd2
    automated match to d3oljd_
    complexed with na

Details for d3olja1

PDB Entry: 3olj (more details), 2.1 Å

PDB Description: Crystal structure of human ribonucleotide reductase subunit M2 (hRRM2)
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3olja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olja1 a.25.1.2 (A:66-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeevdlskdiqhweslkpeery
fishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyik
dpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifw
lkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqeflt
ealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

SCOPe Domain Coordinates for d3olja1:

Click to download the PDB-style file with coordinates for d3olja1.
(The format of our PDB-style files is described here.)

Timeline for d3olja1: