Lineage for d3axab_ (3axa B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122539Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1122830Protein automated matches [190055] (6 species)
    not a true protein
  7. 1122878Species Mus musculus, [TaxId:10090] [195551] (1 PDB entry)
  8. 1122879Domain d3axab_: 3axa B: [195552]
    automated match to d1xz9a1

Details for d3axab_

PDB Entry: 3axa (more details), 2.78 Å

PDB Description: crystal structure of afadin pdz domain in complex with the c-terminal peptide from nectin-3
PDB Compounds: (B:) Afadin, Nectin-3

SCOPe Domain Sequences for d3axab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3axab_ b.36.1.1 (B:) automated matches {Mus musculus, [TaxId: 10090]}
peiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqllsvdgr
slvglsqeraaelmtrtssvvtlevakqgairrewyv

SCOPe Domain Coordinates for d3axab_:

Click to download the PDB-style file with coordinates for d3axab_.
(The format of our PDB-style files is described here.)

Timeline for d3axab_: