PDB entry 3axa

View 3axa on RCSB PDB site
Description: Crystal structure of afadin PDZ domain in complex with the C-terminal peptide from nectin-3
Class: cell adhesion
Keywords: PDZ domain, AF-6, fusion protein, cell adhesion
Deposited on 2011-03-31, released 2012-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Afadin, Nectin-3
    Species: Mus musculus, Mus musculus [TaxId:10090, 10090]
    Gene: Mllt4, Af6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Afadin, Nectin-3
    Species: Mus musculus, Mus musculus [TaxId:10090, 10090]
    Gene: Mllt4, Af6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3axab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3axaB (B:)
    gplgsdhkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaag
    dqllsvdgrslvglsqeraaelmtrtssvvtlevakqgairrewyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axaB (B:)
    peiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqllsvdgr
    slvglsqeraaelmtrtssvvtlevakqgairrewyv