PDB entry 3axa
View 3axa on RCSB PDB site
Description: Crystal structure of afadin PDZ domain in complex with the C-terminal peptide from nectin-3
Class: cell adhesion
Keywords: PDZ domain, AF-6, fusion protein, cell adhesion
Deposited on
2011-03-31, released
2012-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-04-25, with a file datestamp of
2012-04-20.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.241
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Afadin, Nectin-3
Species: Mus musculus, Mus musculus [TaxId:10090, 10090]
Gene: Mllt4, Af6
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Afadin, Nectin-3
Species: Mus musculus, Mus musculus [TaxId:10090, 10090]
Gene: Mllt4, Af6
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3axab_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3axaB (B:)
gplgsdhkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaag
dqllsvdgrslvglsqeraaelmtrtssvvtlevakqgairrewyv
Sequence, based on observed residues (ATOM records): (download)
>3axaB (B:)
peiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqllsvdgr
slvglsqeraaelmtrtssvvtlevakqgairrewyv