![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (35 species) |
![]() | Species Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId:8663] [48631] (1 PDB entry) presynaptic neurotoxic phospholipase A2 |
![]() | Domain d1ae7a_: 1ae7 A: [19553] complexed with so4 |
PDB Entry: 1ae7 (more details), 2 Å
SCOP Domain Sequences for d1ae7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq
Timeline for d1ae7a_: