Lineage for d1ae7a_ (1ae7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733185Species Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId:8663] [48631] (2 PDB entries)
    presynaptic neurotoxic phospholipase A2
  8. 2733186Domain d1ae7a_: 1ae7 A: [19553]
    complexed with so4

Details for d1ae7a_

PDB Entry: 1ae7 (more details), 2 Å

PDB Description: notexin, a presynaptic neurotoxic phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1ae7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]}
nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc
fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

SCOPe Domain Coordinates for d1ae7a_:

Click to download the PDB-style file with coordinates for d1ae7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ae7a_: