PDB entry 1ae7

View 1ae7 on RCSB PDB site
Description: notexin, a presynaptic neurotoxic phospholipase a2
Class: hydrolase
Keywords: hydrolase, phospholipase a2, lipid degradation, presynaptic neurotoxin, venom
Deposited on 1997-03-06, released 1997-05-15
The last revision prior to the SCOP 1.75 freeze date was dated 1997-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Notechis scutatus scutatus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00608 (0-118)
  Domains in SCOP 1.75: d1ae7a_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ae7A (A:)
  nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc
  fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq